Monday, August 07, 2006

Warmed Honey

Yes, recap still owed. I know. Still, this is far more important. No really, it is.
Because, although it took 24 years, I finally got to see BB King in concert on Saturday and it was amazing!
BB King has this incredible spirit that just takes over the moment he steps on stage. He has a fantastic sense of humor and we laughed through much of the evening.
He is 80 and had to sit in a chair as he played but it didn't matter. That man can move.
Maybe it helps that he loves music, loves touring.
When we left that night my husband, my reluctant date, said the three little words every woman wants to hear.

"You were right."

He's never been to a concert before, he's not a music lover in the same vein as I am. But he loved Saturday and has converted to at least being a fan of BB's.

Saturday, August 05, 2006

Note To Self

As you have been told many times in the past 4 years, you have developed an allergy to latex. It eats your skin. It is painful. It takes many weeks to fully heal.
Most band-aids contain latex. Remember? This is how you found out about this whole 'eating of the skin' thing?

So why the hell do you keep forgetting?



This is 2 weeks later.

Dumbass.






Also? ow.

Friday, August 04, 2006

Bastards!

Baxter, poor tortured Cat, has decided that we are simply evil Cat-haters who live only to torment him.
In the past 20 months he has lost his space in our bed, been peed on, jumped at, had his tail chewed on by one teething baby, his eyes have been poked, ears yanked and chased around the house on a daily basis.
Then we bring in new dog. Just when he got used to Auggie and found a way to torment Auggie without being eaten, we bring in Mishka who does not care about boundaries.
Too add insult to injury.........




...... we allowed him to be shaved. Yes, he is sporting last season's lion cut.






My stomach still hurts from laughing.

Thursday, August 03, 2006

Day One: Zoo

Ok so not exactly day one because really day one was when they got there and then day 2 we went grocery shopping and what is there to say about comparing cheeses in the market?
Right.
So technically day 3: Zoo.
Still boring.
I thought it would be great to spend the day walking about staring mindlessly at animals and maybe making some animal noises and such.

Sadly for us we went on the day that all the animals decided to have a napping contest.
Except the hippos and some of the monkeys.
All the rest? Nothing. Not even a sniffle. The orangutans took one look at us and put a burlap bag over their heads. I am fairly certain that given the option they would have preferred the bags on our heads.
And just to make sure that I understood how much this was a bad idea, the day decided to be much colder than it was supposed to be and I had to buy the kids overpriced sweatshirts. My credit card hates me. Deeply hates me.

From the petting zoo where there were no animals to be pet so we had to settle for petting a fly that wouldn't go away.

The hippos which actually are hippos and not plastic things stuck in the water in a lame attempt to fool us that we were looking at real hippos as I had always assumed because they have never moved before. (Your welcome for the endless sentence).


Even the butterflies took the day off.
As we walked the trails in search of some non-snoring type animals, we kept hearing this 'whoop'. Loud and obnoxious.

Then suddenly very fast.

And all too familiar.

Much like the noise I used to pretend I wasn't hearing as my parent's room shared a wall with mine.

Pointing this out to parents proved to be too much and I spent the rest of the trip trying to forget that my parents ever had sex. Ew.

The whooping turned out to be the monkeys. Monkeys which fell asleep just as soon as came over to see them.

Bastards.

I thought we could maybe salvage the day by taking the kids over to the zoo's new playland. Except that it was closed for the day. I guess playlands need their sleep too.

To make the day just perfect, Girl decided to show off her newly honed snarky skills.

I'm still amazed that she didn't somehow end up becoming part of an exhibit.

Tuesday, August 01, 2006

Control

I am truly in no mood for recaps and pictures which will surely take several posts in order to truly capture the events of my parents visit. All culminating in our fully understanding what it means when our heating vent is directly connected to our daughter's room. Because that is where my parents slept. And sound travels.
Ew.
I am feeling particularly sour as I have also begun to fully understand that the next several years are going to leave me in breathless anticipation of the Girl's moving out. Perhaps even more so now that she has informed me of her intention to move as far as she possibly can from wherever I stand.
She is 8. She has hit the 'tween' years. She has found out that I have buttons and oh how she loves to push them.
This morning was a fairly typical sampling of an average day with her.
I wouldn't let her wear her brand new skirt to play outside with Mishka. So instead of simply throwing on some shorts and having fun, she marched around the house in her underwear yelling at everyone to not look at her.
I directed her to her room where she upended the clothing her grandmother had generously folded for her.
Reason does not exist when she gets like this.
Instead, it is much more satisfying to throw a book at me. So she did. And I threw it in the trash (and in the trash it shall remain!).
My natural instinct to throttle her is always overtaken by reason and I walk away. But I cannot deny that innate urge to slap that snotty smug grin.
No, I won't cross that line. Instead I sigh. Count to a bajillion and ground her happy little ass.
The cherry on top of my pie tonight was when she turned to me and said "I guess you're happy now that you've ruined my life!"
Damn skippy, kid. I consider it my privilege and my grandest achievement to ruin your life on a daily basis.

Monday, July 31, 2006

Certifiable

I know I owe a better post than this but vacation isn't technically over until tomorrow. So instead I bring you more proof that we are insane.
How else can I explain the fact that within 6 hours of learning of her existence, we became the very confused owners of Mishka, a 6 week old purebred Alaskan Husky.
Mishka, with the softest gray eyes and the sweetest temperament I have ever seen in a puppy.
When the breeder set her down at our feet she bolted under my legs and hid there, shaken from the car ride that brought her into our lives. She spent the ride to our house with her nose in my armpit, occasionally stealing glances from under my shirt with those lovely gray eyes.
Auggie, the original Dog wonder has taken a fatherly attitude to her.
Baxter, the much-beleaguered Cat, has given up any hope that he may have a peaceful space in this house. He took one look at Mishka and glared at me. Granted, it has been a rather unpleasant weekend for him. My sil shaved him. I believe she called it the 'lion' cut. I took one look at him and nearly peed my pants laughing.
Hurricane's happy squeals and rapid-fire cries for "meeka!" have been greeted with small wet kisses.
Girl melted at Mishka's feet and was treated to gentle nibbles.
Mr X sighed that very defeated sigh. He never wanted a female dog. He had his heart set on one that would maybe not shed so much.
Still, once he knew he'd been defeated, he demanded only the very best in puppy food for her.
He is currently curled up with her. Snoring together.

And I?

I love puppy breath.

And her absolutely ridiculous eyebrows.



Wednesday, July 26, 2006

We Now Interrupt Your Regularly Scheduled Vacation Because OMG! Fuckers!

So what is a really good way to completely fuck up a vacation?

Um. Have your husband 'lose' his wallet at Chucky Cheese On Crack only to find it 6 hours later after someone has taken all of your credit cards, cash and ATM card.

Fuckers.

I hope they use it. Because we cancelled the cards and filed a report with the police and it's a felony and I want them to get arrested and dammitalltheydeservelifeinprison!

And I had a rainbow colada to make me feel better. And another because it was really good. And since I drink exactly never you get semi-drunk blogging and lots of swearing and it's taken me exactically 43 minutes to type this because I have to keep going back or you'll see something more like thiskdf andhi if t dont harfly ,mmmmmmakeee sdenbhse. And I keep forgetting that you are there and I am typiing and OMG I had to cancel all of our fucking credit cards because Fuckers!!

I heart Rainbow Coladas.

That is all.



*Except for OMG poor spell check. I think I maybe broke it. Maybe I should buy it some Coladas too. Mmmmm Captain Morgan's Rum........

**And also except for OMG! What the holy hell people? I have had 8 people find me in the last 2 months by tyoing in "I have worms in me".
Jeebus! Stop putting worms in yourself! I recommend trying alcohol instead.

Thursday, July 20, 2006

Vacation

In less than 3 days my parents will be here for 10 days.
10 days of spoiling the kids rotten.
10 days in which to cram what would normally be 6 months worth of activities.
Hopefully by the end I'll still be somewhat sane. Or at least as intact as I am now.

One thing is for certain, they will provide ample fodder for when I return in August.

Wednesday, July 19, 2006

Mother, Revisited

I had what must seem like the most hideous thoughts the other day. Some women I know were discussing their mothers' hospice care and subsequent deaths. They talked about the things they missed.
Actually, it's a feeling I've had before. I overhear someone discussing how wonderful their mother was. All the things that they did together, all the things that they learned from them.
And I feel envious.
It's something I will never have, those happy memories and lessons learned at my mother's hand that I can then pass on to my own children.
It has been more than 6 years since my mother died and I waver in how I feel about it all.
I can go weeks without even thinking of her.
We looked vastly different. I often heard people ask if she had adopted me, not quite believing that my beautiful blonde, petite and gentle-voiced mother could have possibly birthed a lumbering loud mouth brunette like me.
I don't see her when I look in the mirror.
I don't see her features in the faces of my children.
We shared little in the way of common interests.
Except for my fascination with her when I was young. During that period I loved her nearly as much as she loved herself.
I will walk into a department store and smell her perfume on another woman. It takes me back to her home. When I would be invited to visit, which until I had my daughter was rarely, her entire house would smell of her perfume. And it should have been overwhelming and stifling, instead it was sweet and light.
I catch a glimpse of a woman as she walks confidently through the mall and for a moment my heart catches. Then she turns and I'm left with the feeling that I have missed out on something grand.
When I was a child I had convinced myself that my mother was really Cher. That when she would need to perform she would simply slip into that long black wig. Their features were similar enough to enable my young mind to believe it, to use this as the reason for why she didn't have time for me.
There were many years where we didn't speak to each other at all. During those times she would lavish extravagant gifts on my siblings with the explanation that they had been such very good children. And I was the bad seed.
She used to tell her therapist that I just got 'lost in the shuffle'.
She wasn't all bad. We did have days where just to sit next to her was like Christmas morning.
But the older I got, the less use she really had for me.
It became apparent that I would never be her, never be what she wanted me to be. I would always be too tall, too brunette, too loud, too much my father's child.
I had hoped things would change once my daughter was born. Briefly I was able to convince myself that it had. That her constant invitations and the things she bought for us were because she loved me.
It wasn't until later that I came to understand that she had hoped my small, nearly blonde daughter would be like her. And a part of me is grateful that she is gone, because it means that that transformation will never come to pass.
My general rule of parenting is to imagine what my mother would do and then do the opposite.
Because her death was so sudden, so unexpected, there was never time to say good-bye. I don't know if that would have made a difference or not.
Some days I think I've forgiven her for who she was. That sounds so arrogant doesn't it? I don't mean it to be.
Sometimes I hate her. Sometimes I miss her. I feel guilty and angry. It is an imbalance and an uncomfortable feeling.
I laugh to think of what she would say now, if she knew how I felt.

Often I think that I will never be able to just let it all go.

The thing that keeps me up at night?

Imagining my daughter feeling the same way about me.

Tuesday, July 18, 2006

May They Disappear While I Am Sleeping

I realized today that there are far worse fashion offenses than Clogs.
There are those that crush your soul until all you can do is choke and claim that the wearer is no one you know.




No where in our marriage vows did it say anything out holy socks worn with sandals. I checked.

Monday, July 17, 2006

If It's The Thought That Counts, I'm Afraid Of What This Might Mean

I think that most of the time when I describe my mother-in-law the listener is possibly thinking that I'm exaggerating her craziness, the strange things she says and does. Or, as in this case, gives.

So, this time I took pictures.
I thought I had gotten rid of Scary-Ass Clown when it was given to Hurricane for his birthday. I would have sworn that he had burned in an accidental fire that spontaneously sprung from our backyard.
But no. As I gathered things for our yard sale this weekend, Scary-Ass Clown made an appearance. He eyed me with suspicion as I warily applied a 'Free' sticker to his head. I would happily have paid to have him removed from the house.
In what should be no surprise to anyone, no one wanted him. This morning I took a chance that my MIL would not go to a goodwill 20 miles from her house and buy him again (because she has done this sort of thing before) and left him there.

First, I would like you to note his many pockets. Most would assume that these are for shoes. Hurricane and I came to the same conclusion. Those pockets are to hold spare body parts that Scary-Ass Clown could not consume on the spot.
Hurricane took one look at that creepy grin and started crying, burrowing his head into my neck please don't let that thing eat me!
I also feel the need to point out the eyebrows. Those very furry eyebrows. It feels like real hair. Possibly animal. Certainly not her own as it's the wrong color but I wouldn't have been surprised if it was.

After the bejewelled bird barrette that I buried in the backyard and the lighted moving picture of baby Jesus, now Scary-Ass Clown? I find myself more and more wary of opening her 'gifts'. I have a feeling the next one might actually bite.


I will kill you in your sleep!
Be hypnotized by my overly hair eyebrows!

Friday, July 14, 2006

Welcome Little One.........

Congratulations NK, and welcome to your very sweet little girl!

Thursday, July 13, 2006

Yard Sale Angst

So we decided to sell a bunch of the crap, er, our stuff that we longer need/want/use. I've been getting stuff together and pricing it all for Saturday. Mr X came in and leaned over my shoulder, frowning.
"Don't you think you're pricing that a bit high? Who's going to buy it at that price?"

"Buy it? This is what I'm willing to pay them to take it away."

Seriously. My grandmother was a yard sale queen. It was physically impossible for her to pass one of those signs and not stop. Most of the things she would buy were things that no human being on the planet would ever want or need. Some things that no one recognized as anything other than a hunk or metal or plastic. And she never paid full price. She once argued with a lady for 10 minutes over something priced at a dime. In the time that it took her to aggravate the lady so much that she gave it to my grandmother for free, my brother had decided to see if a car's cigarette lighter would really scar his skin. It does. But hey, my grandma got a thimble from Ohio for free.

My main worry is that no one will show up.

"Gah! No one is going to come and look at this crap! I'm going to be sitting in our driveway surrounded by crap and our neighbors will really think I'm batty and ohmygoshwhatamIdoingthisfor??? ARRRGGHHH!"

"Seriously? Chill out. If no one shows, we'll just call my mom."

Personally? I don't think this was funny.

His sister once tried to get rid of some clothes that she no longer needed since she lost a lot of weight. Her mom came over and took the clothes. She insisted that they could be tailored to fit her daughter again. Currently they are collecting dust amid the other piles of Only-God-Knows-What-That-Is-Oh-Crap-It-Just-Moved! in their garage.

If his mom comes over, we'll never be able to get rid of this stuff. It will just sit in my house and collect dust until the dust magically comes to life and takes over my brain and I become her and oh my gosh no wonder I can't sleep anymore somebody make it stop!!!

So, yes. We're having a yard sale this weekend. Just please for the love of chocolate, don't tell my mother-in-law.

Wednesday, July 12, 2006

Dear Girl,

Many times you have discussed your future with me. Occasionally you have even understood that this future involves you living in your own house apart from me. Other times the thought of not being under my roof seems to frighten you and you insist that you will always want to live here, with us.

There are times you seem uncertain about what your role in life will be. Is it your duty to be a mother and wife? Or are you supposed to go to college and find work? Is there a hard and defined rule to what you are meant for?

When asked at school what you want to be when you grow up, your answers have varied from swim teacher, to lawyer, police officer, amusement park employee or mother.

I want you to know that those things do not have to be exclusive of eachother.

There is no hard and defined rule for you.

No one can tell you what you are meant for my dear girl. Only you.

If there is one thing you get from me, one thing you can hold true, let it be this.

Your fate, your future, cannot be controlled by anyone else. My daughter, your fate is in your hands.


May they always be full.

Monday, July 10, 2006

Sleepless In Seattle

Hello Insomnia, my old friend. It's been almost 6 months since I've seen you. I almost fooled myself into thinking that I was in the clear.
Moron.
At different points in my life I've dealt with bouts of insomnia. As a teen and non-parenty type, it wasn't a big deal.
But once I had kid #1? The insomnia thing sucks.
It's hard to function as a decent parent when you are running on 2 hours of sleep to no sleep for several days in a row.
I just can't get my mind to shut up it's running commentary.
I've been writing this blog for a year now. (Holy shit!) I thought maybe, just maybe, it would help if I had some way to release the stupid things that run through my head all day.
But here I am again. Sitting up in bed, staring out the window as the neighbor's cat chases air around our yard.
Figures. I finally get kid #2 to sleep through the night and I can't.

Sunday, July 09, 2006

Bonding.

I'm sitting on my deck sipping my iced tea on a warm and quiet late morning. I'm watching the kids as they play .
Hurricane runs after Girl as she races after the ball he just kicked. They are both laughing. She grabs for the ball and turns, leaning over.
"Here buddy, kick it!"

He reaches up and grabs her hand to steady himself and kicks the ball.

Again, he follows as she runs for the ball. They play for an hour before it's time to come in for lunch.

He sits in his highchair, she at the table by his side.
He squeals merrily as she contorts lips and eyes into goofy poses for his amusement.
She leans over and whispers something in his ear.
He smiles and touches her nose.

Later, after his nap, they are once again in the backyard. This time in the kiddie pool.
He is waving his arms like a maniac, spraying sheets of water in all directions. She laughs and shows him how to load the plastic fish to squirt.
They play until they are wrinkled a bit chilled.

It is evening now. Dinner is over. The light outside is slowly dimming, the air, cooler. I am cleaning up the kitchen, preparing for the next day.
The kids are bathed, ready for bed. Hair damp and brushed. Pajamas soft and sweet smelling.
He sits in her lap as she reads to him, pointing out the animals in the book, cheering him on as he names a few on his own.
He claps his hands. She smiles.
He leans over and kisses her. She pulls him in for a kiss.

I tuck them both into bed.

Despite those days where I think they'll simply never get along, never accept the other's place in this house, I see it now. What they have is what I had always wanted with my own siblings. I hope it will remain. I wish I could bottle it and feed it to them on Those Days.
Girl had spent so much time talking about how she wanted a sibling, specifically a brother, that I don't think she fully realized what it would mean. She spent 7 years as a one and only. Then one day she had to share it all and it was unsettling.
I remember in the hospital as we handed him to her and she smiled, said 'hi little bro'. I also remember how many times she asked me to just put him away so that we could play again. 19 months later and there are still days I wonder. And then there are these moments that take my breath away.

Watching them now, my heart is full but light. And it's good.

Thursday, July 06, 2006

Betrayal

As usual, my very best intentions have been thwarted by a furry red muppet bastard and his number one fan's sensitive nature.
It seemed like a wonderful idea. A sprinkler made just for babies and toddlers in the shape of Elmo. It sprayed a very fine mist in a rather non-threatening (and thankfully not giggling) manner.
But much like his first encounter with the giggling (and yes. I just now, months later, discovered that those Elmo heads giggle when squeezed. So great, now Hurricane can listen to Elmo giggle maniacally while the muppet gobbles up his toes. Fabulous.) slippers, it did not go as expected.



LaLa my dear friend! It's raining! Come inside with me and
we'll eat cookies and plot to destroy Cat!


Wait! Lala? NO! Say it ain't so!


What the hell mom? What did you
do to my friend?

Ugh. He wanted no part of this thing that spit at him. He sat on the side walk and cried La La Nooooo.......

And in case I didn't already understand just how very strange a boy he was, he decided to reveal his fear of the alphabet.

It started simply enough. I began the afternoon, after he wakes from his nap cheerful and angelic (shut up), as I always do. With a cheerful, if a bit (shut up) off key rendition of the ABC's.

He whimpered when I reached C.

Whined at F.

Rubbed his eyes and threw himself into a heap of warm angst in my lap at H.

Covered my mouth and pleaded for me to stop at M.

Began to cry at P.

R made him yell 'NONONONO!' as he covered his head.

By W he was red-faced and tear streaked, gasping in agony.

Z.

HATE.

I couldn't believe that it was the song that had caused him to react that way.

I tried to sing it again but didn't make it beyond B.

I thought maybe he was turning into Simon Cowell thanks to his father's secret addiction to American Idol.

So I sang Twinkle Twinkle Little Star (it has the same tune as ABC), and he clapped and smiled.

I waited until Mr X got him.

"Watch this."

I made it to D before his little body burst into flames and the letters simply smothered him.

"Whoa."

Mr X tried to sing it for him.

He was immediately tackled and bludgeoned with a Weeble.

I am not sure what sort of falling out my son has had with the alphabet. Only that it was so severe as to have caused their banishment.

Sesame Street has never been so sad.

Wednesday, July 05, 2006

She'll Have What He's Having

Once upon a time, not terribly long ago, I dreaded the 4th of July. The fireworks lit by idiot neighbors hell bent on setting our house on fire, the fireworks lit by certain unnamed individuals who very nearly blew themselves up as they stood over fireworks lit by other certain unnamed individuals (and for once it wasn't me!), the loud booming, the smoke, the residue that thickly coated everything on our street.
No, that hasn't changed. There are still people on our street who think fireworks safety involves pointing the roman candle up in the air and holding it IN THEIR HANDS as they light it. Our street is littered with casings and only a few body parts. Ash has coated my van in fine gray film.

What has changed is that I now have my very own drug dealer. Someone I hold very dear for they have made it possible to actually leave my house on 4th of July and enjoy the neighbors injuries in person without worrying that our overgrown lap dog has hurled himself through a window in an effort to rescue us from the Smoke! and the Noise! and My G-d Don't These Humans Know They Are In DANGER????

Yes, our lovable brute of Dog has one true fear. Fireworks.
He paces and cries. He buries his head under the bed and whines. He hides in the bathtub and howls. And should we dare to attempt to leave the house and put ourselves in such close proximity to the danger, well. He feels morally obligated to protect us from ourselves.
We realized this the year we left a window open and he jumped through the screen to 'save' us.
So now we happily sedate him. And because of where we live, we must do this for several days. He spends about 4 to 5 days happily wandering through the house in a daze. I imagine it to be like taking care of a very stoned old man. He stumbles and pants. His eyes go from being ridiculously wide open to all squinty and bloodshot. If he is not quite where you left him, simply follow the trail of drool to the kitchen where you will find him looking rather forlornly at the pantry where all the good trash is. Also? Cookies. Human cookies. Also? The staring. At nothing. Yesterday I found him in the hallway staring at the nightlight. I snapped my fingers, called his name, waved food in his general direction but he didn't budge. Just drooled.

Yesterday we spent a large portion of our time laughing at our inebriated dog (as he was sadly the only inebriated one in our house) and trying to confine Hurricane to his own body.

Yesterday was also the day I realized just how different my two children will be.
My dear Girl. She and Dog have much in common. We had to physically carry her off the porch. She wouldn't go near the sparklers much less actually hold one.
In fact, I think her exact words were Are you insane? I'm not touching that and you can't make me lunatic!
I suggested that she go inside and watch from under the bed as Dog often did but she did finally, albeit reluctantly, join us.
She cried. A lot. At first anyway.
By the end though, she actually held a sparkler. Granted it had already been lit for awhile and it only had a few seconds left. Also, she held t as far away from her body as possible and looked as though she may drop it and run at any second. But she did it. And I was proud of her.

Hurricane. Geez. That kid went ape shit. He didn't know whether to sit, stand, or dance. So he did all three. All night.
He pointed and his body shook.
Whoa!!!! OOOOOOOO!!!! WOWWOWWOW!
We had to hold onto him at one point to keep him from running into the street and grabbing the fountain of fireworks our neighbor had set off. He wanted so desperately to hold the pretty lights.
He turned and twisted, craning his neck to see everything being set off. He was in awe.
By the end of our night he was in arms, his head resting against mine. The people who live behind us set off their grand finale and as we watched the sky light up in purple, red, blue and green, Hurricane whispered wow, so softly. I think that summed it all up for him perfectly.

Today as we left the house he lifted his face to the sky in search of those pretty lights he loved so much. When there was no grand show, he hunched his shoulders, raised his arms palms up, bent at the elbows and simply asked where the boo?

Girl simply breathed. Relief. She has 364 days before she will once again be wishing she was Dog.

Thursday, June 29, 2006

Please Tell Me She Snores.

The Girl had her martial arts thing today. Hurricane and I sat off to the side, half watching. Mostly he tried to run out there and join her.

Finally I gave up trying to hold him back and strapped him to his high chair. For my effort I was treated to the Glare and Growl. I say growl but really? It's funny. Unless you've seen The Grudge, Then not so much. Because you know the part where the wet misshapen Asian girl opens her mouth and makes that guttural noise? Hurricane does an excellent impression that sends ice water down my spine.

In an effort to distract him I ran my fingers up and down his back through the fabric of the umbrella stroller. He is so very ticklish and his back is one of the worst spots.

He squealed and his eyes got wide.

I did it again.

He jumped and laughed. I started laughing too and then it happened.

I snorted.

Yes. I sometimes snort when I laugh. In fact, if I'm really laughing, there's going to be a snort in there somewhere.

Most of the time I can disguise it. Or it's soft enough that no one notices.

This was not one of those times. This was one of those times that one of those 'perfect' moms had to be nearby and of course heard me. And laughed and of course told her equally perfect husband who looked at me and smirked.

She was lean, platinum blonde, perfect teeth, manicured nails and impeccably dressed.

The type that makes me feel as though I've been playing in my mother's makeup.

And I snort when I laugh. Dork.

Wednesday, June 28, 2006

Things My Mother Never Told Me

Boy is that ever a loaded title. I think it would be a shorter post to simply put down the things she did tell me. Hmm. Maybe the things she told me that were useful. Yes. That would be a very brief post.

Perhaps a more appropriate title would have been "Things Other Mothers Probably Didn't Tell Their Daughters About Parenthood That Maybe Would Have Been Helpful. Or Not. But We'll Never Know Because They Didn't Tell Us."
But I don't think that title would have fit so well. You get the point. (shut up dumbass!- Says me. To me.)

*It will soon seem perfectly normal to have a child climbing into your lap as attempt to pee.

*Boys need to be pointed south.

*If you do not point them south, you will get very wet very quickly.

*An 8 year old can demolish a bathroom in 3 minutes flat given the proper motivation and the aid of a toddler armed with a rubber ducky and a love of toilets and flushing.

*Rubber duckies do not fit down the toilet. But they can get stuck just enough to cause a flood.

*Silence is scary. It means the children have found something interesting (Read: destructive) to do. Sometimes the screaming is a good thing.

*Cats don't like oatmeal. Not even if it's blue and made in one of your kitchen drawers by one very bored child.

*Children repeat the one word you wish they hadn't heard. Often at the most unfortunate moment. Like at your grandparent's anniversary dinner when she (3 at the time) asks your grandmother to pass the fucking rice. Be grateful grandma can't hear well.

*Children have the uncanny ability to physically harm you when you least expect it. Like the head butting thing I mentioned before? The one where you think it's entirely possible that your toddler just broke your nose? Or when they actually do break your glasses? (Yes. He did.)

*When it comes to food, kids can be damn picky. They will not eat simply because you told them too. Yes, mixed vegetable have to be separated before this one will eat them. That one won't eat anything on the plate if there is even a hint of vegetable in there. This one won't eat things that are red. That one will only eat things that can be made into finger food.

*Kids can also be extremely possessive of said food. Like when the girl stabbed her grandpa in the hand with her fork when he tried to take a bite of her pancake. Or when version 2.0 took a bite out of girl for taking a bite out of his ice cream.

*Kids know what the ice cream truck is on instinct. It doesn't matter how many times you tell them that music is for the vegetable truck, they know.

*Children like sticking stuff in holes. Cover your nose or you'll get woken up when one of them decides to shove one of your tampons (which they really loved unwrapping and dipping into the toilet first) up your nostril. Nothing like a little toilet water in your nose to start your day.

*A child who can memorize 3 Shel Silverstein poems in 2 days for a theater camp production will not remember to flush a toilet even though you have been begging her for 2 years to please for pete's sake flush!

*Toothpaste to child is as paint to Picasso. (Also, according to Sarcastic Journalist, poop. Thank you dear Lord for sparing me on this one.)

*Pen does not easily come out of most flooring.

*You will, on occasion, lose your shit.

*Kids like to bang their heads on things. Hard. It's loud and will freak you out but will not cause any brain damage. I hope. (and I also kind of hope that it isn't just my kids who do this because otherwise. Shit.)

*It doesn't matter where you hide that really loud annoying toy. They will find it. Even if you wrap it up in plastic bags and bury it in the garbage bag under the 'leftovers' from your MIL's house.